BETA-AMYLOID (1-43) CAS#: 134500-80-4; ChemWhat Code: 98348
Names & Identifiers |
| Product Name | BETA-AMYLOID (1-43) |
| Synonyms | BETA-AMYLOID (1-43);BETA-AMYLOID (1-43) PEPTIDE;BETA-AMYLOID PEPTIDE [1-43], HUMAN;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT;H2N-D-A-E-F-R-H-D-S-G-Y-E-V-H-H-Q-K-L-V-F-F-A-E-D-V-G-S-N-K-G-A-I-I-G-L-M-V-G-G-V-V-I-A-T-OH;H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-OH;A-BETA (1-43);AMYLOID BETA-PROTEIN (1-43) |
| CAS Registry Number | 134500-80-4 |
| Molecular Formula | C207H318N56O62S1 |
| Molecular Weight | 4615.14 |
| EINECS | |
| Other Registry Numbers | ; |
| More Identifiers on PubChem | IUPA Names, InChI, InChI Key, Canonical SMILES, etc. |
Chemical & Physical Properties |
| Storage | −20°C |
Safety & Hazards(Codes & Phrases) |
| WGK Germany | 3 |
| More Safety & Hazards From PubChem | Signal, GHS Hazard Statements, Precautionary Statement Codes, etc. |
Literature |
| Literature on PubChem | Synthesis References, Metabolite References, etc. |
Patents |
| Patents on PubChem | Related Patents Of This Product |
Transportation, Storage & Usage |
| Transportation | No Information |
| Storage | No Information |
| Usage | No Information |
Spectral Properties |
| No Information |
Buy Reagent | |
| No reagent supplier? | Send quick inquiry to ChemWhat |
| Want to be listed here as a reagent supplier? (Paid service) | Click here to contact ChemWhat |
Approved Manufacturers | |
| Want to be listed as an approved manufacturer (Requires approvement)? | Please download and fill out this form and send back to approved-manufacturers@chemwhat.com |
Other Suppliers | |
| Watson International Limited | Visit Watson Official Website |
Contact Us for Other Help | |
| Contact us for other information or services | Click here to contact ChemWhat |
