CECROPIN B CAS#: 80451-05-4; ChemWhat Code: 1184582
Names & Identifiers |
| Product Name | CECROPIN B |
| Synonyms | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;CECROPIN B;Aids096161;Aids-096161;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI) |
| CAS Registry Number | 80451-05-4 |
| Molecular Formula | C176H302N52O41S |
| Molecular Weight | 3834.66988 |
| EINECS | |
| Other Registry Numbers | |
| More Identifiers on PubChem | 80451-05-4.mol |
 |
|
Chemical & Physical Properties |
| Storage | −20°C |
| form | powder |
Safety & Hazards(Codes & Phrases) |
| WGK Germany | 3 |
| More Safety & Hazards From PubChem | Signal, GHS Hazard Statements, Precautionary Statement Codes, etc. |
Literature |
| Literature on PubChem | Synthesis References, Metabolite References, etc. |
Patents |
| Patents on PubChem | Related Patents Of This Product |
Transportation, Storage & Usage |
| Transportation | No Information |
| Storage | No Information |
| Usage | No Information |
Spectral Properties |
| No Information |
Buy Reagent | |
| No reagent supplier? | Send quick inquiry to ChemWhat |
| Want to be listed here as a reagent supplier? (Paid service) | Click here to contact ChemWhat |
Approved Manufacturers | |
| Want to be listed as an approved manufacturer (Requires approvement)? | Please download and fill out this form and send back to approved-manufacturers@chemwhat.com |
Other Suppliers | |
| Watson International Limited | Visit Watson Official Website |
Contact Us for Other Help | |
| Contact us for other information or services | Click here to contact ChemWhat |